Recombinant Human DUSP13 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DUSP13-482H
Product Overview : DUSP13 MS Standard C13 and N15-labeled recombinant protein (NP_001007273) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In mouse, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined.
Molecular Mass : 27.3 kDa
AA Sequence : MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAMDSLQKQDLRRPKIHGAVQASPYQPPTLASLQRLLWVRQAATLNHIDEVWPSLFLGDAYAARDKSKLIQLGITHVVNAAAGKFQVDTGAKFYRGMSLEYYGIEADDNPFFDLSVYFLPVARYIRAALSVPQGRVLVHCAMGVSRSATLVLAFLMICENMTLVEAIQTVQAHRNICPNSGFLRQLQVLDNRLGRETGRFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DUSP13 dual specificity phosphatase 13 [ Homo sapiens (human) ]
Official Symbol DUSP13
Synonyms DUSP13; dual specificity phosphatase 13; dual specificity protein phosphatase 13; BEDP; DUSP13A; DUSP13B; FLJ32450; TMDP; muscle-restricted DSP; branching-enzyme interacting DSP; dual specificity phosphatase SKRP4; testis- and skeletal-muscle-specific DSP; branching-enzyme interacting dual-specificity protein phosphatase; MDSP; SKRP4;
Gene ID 51207
mRNA Refseq NM_001007272
Protein Refseq NP_001007273
MIM 613191
UniProt ID Q6B8I1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DUSP13 Products

Required fields are marked with *

My Review for All DUSP13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon