Recombinant Human DUSP13 protein, His-SUMO-tagged

Cat.No. : DUSP13-4541H
Product Overview : Recombinant Human DUSP13 protein(Q6B8I1)(1-198aa), fused to N-terminal His-SUMO tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-198aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.7 kDa
AA Sequence : MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name DUSP13 dual specificity phosphatase 13 [ Homo sapiens ]
Official Symbol DUSP13
Synonyms DUSP13; dual specificity phosphatase 13; dual specificity protein phosphatase 13; BEDP; DUSP13A; DUSP13B; FLJ32450; TMDP; muscle-restricted DSP; branching-enzyme interacting DSP; dual specificity phosphatase SKRP4; testis- and skeletal-muscle-specific DSP; branching-enzyme interacting dual-specificity protein phosphatase; MDSP; SKRP4;
Gene ID 51207
mRNA Refseq NM_001007271
Protein Refseq NP_001007272
MIM 613191
UniProt ID Q6B8I1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DUSP13 Products

Required fields are marked with *

My Review for All DUSP13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon