Recombinant Human DUSP13 protein, His-SUMO-tagged
Cat.No. : | DUSP13-4541H |
Product Overview : | Recombinant Human DUSP13 protein(Q6B8I1)(1-198aa), fused to N-terminal His-SUMO tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-198aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.7 kDa |
AA Sequence : | MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNAAHKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPGAKVLVHCVVGVSRSATLVLAYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DUSP13 dual specificity phosphatase 13 [ Homo sapiens ] |
Official Symbol | DUSP13 |
Synonyms | DUSP13; dual specificity phosphatase 13; dual specificity protein phosphatase 13; BEDP; DUSP13A; DUSP13B; FLJ32450; TMDP; muscle-restricted DSP; branching-enzyme interacting DSP; dual specificity phosphatase SKRP4; testis- and skeletal-muscle-specific DSP; branching-enzyme interacting dual-specificity protein phosphatase; MDSP; SKRP4; |
Gene ID | 51207 |
mRNA Refseq | NM_001007271 |
Protein Refseq | NP_001007272 |
MIM | 613191 |
UniProt ID | Q6B8I1 |
◆ Recombinant Proteins | ||
DUSP13-4878M | Recombinant Mouse DUSP13 Protein | +Inquiry |
DUSP13-482H | Recombinant Human DUSP13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DUSP13-12206H | Recombinant Human DUSP13, GST-tagged | +Inquiry |
DUSP13-5628H | Recombinant Human DUSP13 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DUSP13-2927H | Recombinant Human DUSP13 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DUSP13 Products
Required fields are marked with *
My Review for All DUSP13 Products
Required fields are marked with *
0
Inquiry Basket