Recombinant Human DTWD1 Protein (1-109 aa), GST-tagged

Cat.No. : DTWD1-462H
Product Overview : Recombinant Human DTWD1 Protein (1-109 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-109 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 39.2 kDa
AA Sequence : MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name DTWD1 DTW domain containing 1 [ Homo sapiens (human) ]
Official Symbol DTWD1
Synonyms MDS009;
Gene ID 56986
mRNA Refseq NM_001144955
Protein Refseq NP_001138427
UniProt ID Q8N5C7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DTWD1 Products

Required fields are marked with *

My Review for All DTWD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon