Recombinant Human DTWD1 Protein, GST-tagged

• Cat.No.: DTWD1-2904H
• Product Overview: Human DTWD1 full-length ORF ( NP_064619.2, 1 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DTWD1 (DTW Domain Containing 1) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 61.6 kDa
• AA Sequence: MSLNPPIFLKRSEENSSKFVETKQSQTTSIASEDPLQNLCLASQEVLQKAQQSGRSKCLKCGGSRMFYCYTCYVPVENVPIEQIPLVKLPLKIDIIKHPNETDGKSTAIHAKLLAPEFVNIYTYPCIPEYEEKDHEVALIFPGPQSISIKDISFHLQKRIQNNVRGKNDDPDKPSFKRKRTEEQEFCDLNDSKCKGTTLKKIIFIDSTWNQTNKIFTDERLQGLLQVELKTRKTCFWRHQKGKPDTFLSTIEAIYYFLVDYHTDILKEKYRGQYDNLLFFYSFMYQLIKNAKCSGDKETGKLTH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DTWD1 DTW domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: DTWD1
• Synonyms: DTWD1; DTW domain containing 1; DTW Domain Containing 1; DTW Domain-Containing Protein 1; X 009 Protein; MDS009; DTW domain-containing protein 1; x 009 protein
• Gene ID: 56986
• mRNA Refseq: NM_001144955
• Protein Refseq: NP_001138427
• UniProt ID: Q8N5C7