Recombinant Human DTNBP1, His-tagged
Cat.No. : | DTNBP1-26932TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-351 of Human Dysbindin with an N terminal His tag. Predicted mwt: 40 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-351 a.a. |
Description : | This gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. A similar protein in mouse is a component of a protein complex termed biogenesis of lysosome-related organelles complex 1 (BLOC-1), and binds to alpha- and beta-dystrobrevins, which are components of the dystrophin-associated protein complex (DPC). Mutations in this gene are associated with Hermansky-Pudlak syndrome type 7. This gene may also be associated with schizophrenia. Multiple transcript variants encoding distinct isoforms have been identified for this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 85 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLETLRERLLSVQQDFTSGLKTLSDKSREAKVKSKPRTVP FLPKYSAGLELLSRYEDTWAALHRRAKDCASAGELVDS EVVMLSAHWEKKKTSLVELQEQLQQLPALIADLESMTA NLTHLEASFEEVENNLLHLEDLCGQCELERCKHMQSQQ LENYKKNKRKELETFKAELDAEHAQKVLEMEHTQQMKLKE RQKFFEEAFQQDMEQYLSTGYLQIAERREPIGSMSSME VNVDMLEQMDLMDISDQEALDVFLNSGGEENTVLSPAL GPESSTCQNEITLQVPNPSELRAKPPSSSSTCTDSATR DISEGGESPVVQSDEEEVQVDTALATSHTDREATPDGG EDSDS |
Full Length : | Full L. |
Gene Name | DTNBP1 dystrobrevin binding protein 1 [ Homo sapiens ] |
Official Symbol | DTNBP1 |
Synonyms | DTNBP1; dystrobrevin binding protein 1; dysbindin; DBND; Dysbindin; HPS7; My031; |
Gene ID | 84062 |
mRNA Refseq | NM_032122 |
Protein Refseq | NP_115498 |
MIM | 607145 |
Uniprot ID | Q96EV8 |
Chromosome Location | 6p22.3 |
Pathway | Clathrin derived vesicle budding, organism-specific biosystem; Golgi Associated Vesicle Biogenesis, organism-specific biosystem; Membrane Trafficking, organism-specific biosystem; trans-Golgi Network Vesicle Budding, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
Dtnbp1-683R | Recombinant Rat Dtnbp1 Protein, His-tagged | +Inquiry |
DTNBP1-26457TH | Recombinant Human DTNBP1, His-tagged | +Inquiry |
DTNBP1-26932TH | Recombinant Human DTNBP1, His-tagged | +Inquiry |
DTNBP1-1966R | Recombinant Rat DTNBP1 Protein | +Inquiry |
DTNBP1-4063HF | Recombinant Full Length Human DTNBP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DTNBP1-6796HCL | Recombinant Human DTNBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DTNBP1 Products
Required fields are marked with *
My Review for All DTNBP1 Products
Required fields are marked with *
0
Inquiry Basket