Recombinant Human DTNA Protein, GST-tagged
Cat.No. : | DTNA-2899H |
Product Overview : | Human DTNA full-length ORF ( AAH05300, 1 a.a. - 371 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 66.55 kDa |
AA Sequence : | MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHSVPSSGSPFITRSSDGAFGGCV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DTNA dystrobrevin, alpha [ Homo sapiens ] |
Official Symbol | DTNA |
Synonyms | DTNA; dystrobrevin, alpha; dystrobrevin alpha; D18S892E; DRP3; DTN; DTN 1; DTN 2; DTN 3; dystrophin related protein 3; dystrophin-related protein 3; DTN-A; LVNC1; FLJ96209; |
Gene ID | 1837 |
mRNA Refseq | NM_001128175 |
Protein Refseq | NP_001121647 |
MIM | 601239 |
UniProt ID | Q9Y4J8 |
◆ Recombinant Proteins | ||
DTNA-4059HF | Recombinant Full Length Human DTNA Protein, GST-tagged | +Inquiry |
DTNA-2899H | Recombinant Human DTNA Protein, GST-tagged | +Inquiry |
Dtna-2670M | Recombinant Mouse Dtna Protein, Myc/DDK-tagged | +Inquiry |
DTNA-546H | Recombinant Human DTNA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DTNA-5077Z | Recombinant Zebrafish DTNA | +Inquiry |
◆ Cell & Tissue Lysates | ||
DTNA-6800HCL | Recombinant Human DTNA 293 Cell Lysate | +Inquiry |
DTNA-6799HCL | Recombinant Human DTNA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DTNA Products
Required fields are marked with *
My Review for All DTNA Products
Required fields are marked with *
0
Inquiry Basket