Recombinant Human DSTN protein, GST-tagged
Cat.No. : | DSTN-30180H |
Product Overview : | Recombinant Human DSTN (1-165 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Val165 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDVGVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASSKDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | DSTN destrin (actin depolymerizing factor) [ Homo sapiens ] |
Official Symbol | DSTN |
Synonyms | DSTN; destrin (actin depolymerizing factor); destrin; ACTDP; ADF; actin-depolymerizing factor; bA462D18.2 (destrin (actin depolymerizing factor ADF) (ACTDP)); bA462D18.2; |
Gene ID | 11034 |
mRNA Refseq | NM_001011546 |
Protein Refseq | NP_001011546 |
MIM | 609114 |
UniProt ID | P60981 |
◆ Recombinant Proteins | ||
DSTN-1337R | Recombinant Rhesus monkey DSTN Protein, His-tagged | +Inquiry |
DSTN-30180H | Recombinant Human DSTN protein, GST-tagged | +Inquiry |
DSTN-26582TH | Recombinant Human DSTN, His-tagged | +Inquiry |
DSTN-1963R | Recombinant Rat DSTN Protein | +Inquiry |
DSTN-1638H | Recombinant Human DSTN protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DSTN-6805HCL | Recombinant Human DSTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DSTN Products
Required fields are marked with *
My Review for All DSTN Products
Required fields are marked with *
0
Inquiry Basket