Recombinant Human DSPP protein, GST-tagged
Cat.No. : | DSPP-301524H |
Product Overview : | Recombinant Human DSPP (18-296 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met18-Gly296 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MVPQSKPLERHVEKSMNLHLLARSNVSVQDELNASGTIKESGVLVHEGDRGRQENTQDGHKGEGNGSKWAEVGGKSFSTYSTLANEEGNIEGWNGDTGKAETYGHDGIHGKEENITANGIQGQVSIIDNAGATNRSNTNGNTDKNTQNGDVGDAGHNEDVAVVQEDGPQVAGSNNSTDNEDEIIENSCRNEGNTSEITPQINSKRNGTKEAEVTPGTGEDAGLDNSDGSPSGNGADEDEDEGSGDDEDEEAGNGKDSSNNSKGQEGQDHGKEDDHDSSIG |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | DSPP dentin sialophosphoprotein [ Homo sapiens (human) ] |
Official Symbol | DSPP |
Synonyms | DPP; DSP; DGI1; DMP3; DFNA39 |
Gene ID | 1834 |
mRNA Refseq | NM_014208 |
Protein Refseq | NP_055023 |
MIM | 125485 |
UniProt ID | Q9NZW4 |
◆ Recombinant Proteins | ||
DSPP-301524H | Recombinant Human DSPP protein, GST-tagged | +Inquiry |
DSPP-1390H | Recombinant Human DSPP Protein, His&GST-tagged | +Inquiry |
DSPP-2002H | Recombinant Human DSPP Protein (Ile16-Ala146), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DSPP Products
Required fields are marked with *
My Review for All DSPP Products
Required fields are marked with *
0
Inquiry Basket