Recombinant Human DSG4 Protein, GST-tagged

Cat.No. : DSG4-2891H
Product Overview : Human DSG4 partial ORF ( NP_817123, 531 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the desmoglein subgroup of desmosomal cadherins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a transmembrane component of desmosomes and may play a role in cell-cell adhesion in epithelial cells. Mutations in the gene are associated with localized autosomal recessive hypotrichosis and monilethrix, characterized by impaired hair growth. [provided by RefSeq, May 2016]
Molecular Mass : 36.74 kDa
AA Sequence : EPPGIADMWDVRSTNATSAILTAKQVLSPGFYEIPILVKDSYNRACELAQMVQLYACDCDDNHMCLDSGAAGIYTEDITGDTYGPVTEDQAGVSNVGLGP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DSG4 desmoglein 4 [ Homo sapiens ]
Official Symbol DSG4
Synonyms DSG4; desmoglein 4; desmoglein-4; CDHF13; LAH; CDH family member 13; cadherin family member 13; CDGF13;
Gene ID 147409
mRNA Refseq NM_001134453
Protein Refseq NP_001127925
MIM 607892
UniProt ID Q86SJ6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DSG4 Products

Required fields are marked with *

My Review for All DSG4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon