Recombinant Human DSG4 Protein, GST-tagged

• Cat.No.: DSG4-2891H
• Product Overview: Human DSG4 partial ORF ( NP_817123, 531 a.a. - 630 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the desmoglein subgroup of desmosomal cadherins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a transmembrane component of desmosomes and may play a role in cell-cell adhesion in epithelial cells. Mutations in the gene are associated with localized autosomal recessive hypotrichosis and monilethrix, characterized by impaired hair growth. [provided by RefSeq, May 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: EPPGIADMWDVRSTNATSAILTAKQVLSPGFYEIPILVKDSYNRACELAQMVQLYACDCDDNHMCLDSGAAGIYTEDITGDTYGPVTEDQAGVSNVGLGP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DSG4 desmoglein 4 [ Homo sapiens ]
• Official Symbol: DSG4
• Synonyms: DSG4; desmoglein 4; desmoglein-4; CDHF13; LAH; CDH family member 13; cadherin family member 13; CDGF13
• Gene ID: 147409
• mRNA Refseq: NM_001134453
• Protein Refseq: NP_001127925
• MIM: 607892
• UniProt ID: Q86SJ6