Recombinant Human DSCR9 Protein, GST-tagged

• Cat.No.: DSCR9-2887H
• Product Overview: Human DSCR9 full-length ORF ( NP_683516.1, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DSCR9 (Down Syndrome Critical Region 9 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class. Diseases associated with DSCR9 include Down Syndrome.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 43.1 kDa
• AA Sequence: MGRICPVNSRARRLRARPGRPSGDSLPYHQLQGGAPRLWSPDPGRPAAYRRAHVCDVTAPRWGSTSRQGEGAVLQRMLGRRAPPSWSRDHAYSRRGWENAALFLNRKRKQEGTENTSICCRPESALACGGNLSPQFLKKVIQIQTQELW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DSCR9 Down syndrome critical region gene 9 (non-protein coding) [ Homo sapiens (human) ]
• Official Symbol: DSCR9
• Synonyms: NCRNA00038; Down syndrome critical region gene 9 (non-protein coding); DSCR9
• Gene ID: 257203
• UniProt ID: P59020