Recombinant Human DSCR9 Protein, GST-tagged
Cat.No. : | DSCR9-2887H |
Product Overview : | Human DSCR9 full-length ORF ( NP_683516.1, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DSCR9 (Down Syndrome Critical Region 9 (Non-Protein Coding)) is an RNA Gene, and is affiliated with the non-coding RNA class. Diseases associated with DSCR9 include Down Syndrome. |
Molecular Mass : | 43.1 kDa |
AA Sequence : | MGRICPVNSRARRLRARPGRPSGDSLPYHQLQGGAPRLWSPDPGRPAAYRRAHVCDVTAPRWGSTSRQGEGAVLQRMLGRRAPPSWSRDHAYSRRGWENAALFLNRKRKQEGTENTSICCRPESALACGGNLSPQFLKKVIQIQTQELW |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DSCR9 Down syndrome critical region gene 9 (non-protein coding) [ Homo sapiens (human) ] |
Official Symbol | DSCR9 |
Synonyms | NCRNA00038; Down syndrome critical region gene 9 (non-protein coding); DSCR9 |
Gene ID | 257203 |
UniProt ID | P59020 |
◆ Recombinant Proteins | ||
DSCR9-4236HF | Recombinant Full Length Human DSCR9 Protein, GST-tagged | +Inquiry |
DSCR9-2887H | Recombinant Human DSCR9 Protein, GST-tagged | +Inquiry |
DSCR9-12176H | Recombinant Human DSCR9, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DSCR9-6808HCL | Recombinant Human DSCR9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DSCR9 Products
Required fields are marked with *
My Review for All DSCR9 Products
Required fields are marked with *
0
Inquiry Basket