Recombinant Human DSCAM Protein, GST-tagged
Cat.No. : | DSCAM-2882H |
Product Overview : | Human DSCAM partial ORF ( NP_001380, 184 a.a. - 271 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the immunoglobulin superfamily of cell adhesion molecules (Ig-CAMs), and is involved in human central and peripheral nervous system development. This gene is a candidate for Down syndrome and congenital heart disease (DSCHD). A gene encoding a similar Ig-CAM protein is located on chromosome 11. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2012] |
Molecular Mass : | 35.42 kDa |
AA Sequence : | KDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGRF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DSCAM Down syndrome cell adhesion molecule [ Homo sapiens ] |
Official Symbol | DSCAM |
Synonyms | DSCAM; Down syndrome cell adhesion molecule; CHD2 42; CHD2 52; CHD2; human CHD2-52 down syndrome cell adhesion molecule; CHD2-42; CHD2-52; |
Gene ID | 1826 |
mRNA Refseq | NM_001389 |
Protein Refseq | NP_001380 |
MIM | 602523 |
UniProt ID | O60469 |
◆ Recombinant Proteins | ||
DSCAM-1961R | Recombinant Rat DSCAM Protein | +Inquiry |
DSCAM-1620R | Recombinant Rat DSCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
DSCAM-12170H | Recombinant Human DSCAM, His-tagged | +Inquiry |
DSCAM-2535M | Recombinant Mouse DSCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
DSCAM-4834M | Recombinant Mouse DSCAM Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DSCAM Products
Required fields are marked with *
My Review for All DSCAM Products
Required fields are marked with *
0
Inquiry Basket