Recombinant Human DSCAM Protein, GST-tagged

• Cat.No.: DSCAM-2882H
• Product Overview: Human DSCAM partial ORF ( NP_001380, 184 a.a. - 271 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the immunoglobulin superfamily of cell adhesion molecules (Ig-CAMs), and is involved in human central and peripheral nervous system development. This gene is a candidate for Down syndrome and congenital heart disease (DSCHD). A gene encoding a similar Ig-CAM protein is located on chromosome 11. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Oct 2012]
• Molecular Mass: 35.42 kDa
• AA Sequence: KDVQNEDGLYNYRCITRHRYTGETRQSNSARLFVSDPANSAPSILDGFDHRKAMAGQRVELPCKALGHPEPDYRWLKDNMPLELSGRF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DSCAM Down syndrome cell adhesion molecule [ Homo sapiens ]
• Official Symbol: DSCAM
• Synonyms: DSCAM; Down syndrome cell adhesion molecule; CHD2 42; CHD2 52; CHD2; human CHD2-52 down syndrome cell adhesion molecule; CHD2-42; CHD2-52
• Gene ID: 1826
• mRNA Refseq: NM_001389
• Protein Refseq: NP_001380
• MIM: 602523
• UniProt ID: O60469