Recombinant Human DSC2 protein(771-890 aa), C-His-tagged

• Cat.No.: DSC2-2821H
• Product Overview: Recombinant Human DSC2 protein(Q02487)(771-890 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 771-890 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: TVGSGIKNGGQETIEMVKGGHQTSESCRGAGHHHTLDSCRGGHTEVDNCRYTYSEWHSFTQPRLGEKVYLCNQDENHKHAQDYVLTYNYEGRGSVAGSVGCCSERQEEDGLEFLDNLEPK
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: DSC2 desmocollin 2 [ Homo sapiens ]
• Official Symbol: DSC2
• Synonyms: DSC2; desmocollin 2; DSC3; desmocollin-2; CDHF2; cadherin family member 2; desmosomal glycoprotein II; desmosomal glycoprotein III; desmosomal glycoprotein II/III; DG2; ARVD11; DGII/III; DKFZp686I11137
• Gene ID: 1824
• mRNA Refseq: NM_004949
• Protein Refseq: NP_004940
• MIM: 125645
• UniProt ID: Q02487