Recombinant Human DSC1 protein(791-870 aa), C-His-tagged

• Cat.No.: DSC1-2832H
• Product Overview: Recombinant Human DSC1 protein(Q08554)(791-870 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 791-870 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SNKGGGHQTLESVKGVGQGDTGRYAYTDWQSFTQPRLGEKVYLCGQDEEHKHCEDYVCSYNYEGKGSLAGSVGCCSDRQE

Gene Information

• Gene Name: DSC1 desmocollin 1 [ Homo sapiens ]
• Official Symbol: DSC1
• Synonyms: DSC1; desmocollin 1; desmocollin-1; CDHF1; cadherin family member 1; desmosomal glycoprotein 2/3; DG2/DG3
• Gene ID: 1823
• mRNA Refseq: NM_004948
• Protein Refseq: NP_004939
• MIM: 125643
• UniProt ID: Q08554