Recombinant Human DSC1 protein(791-870 aa), C-His-tagged

Cat.No. : DSC1-2832H
Product Overview : Recombinant Human DSC1 protein(Q08554)(791-870 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 791-870 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SNKGGGHQTLESVKGVGQGDTGRYAYTDWQSFTQPRLGEKVYLCGQDEEHKHCEDYVCSYNYEGKGSLAGSVGCCSDRQE
Gene Name DSC1 desmocollin 1 [ Homo sapiens ]
Official Symbol DSC1
Synonyms DSC1; desmocollin 1; desmocollin-1; CDHF1; cadherin family member 1; desmosomal glycoprotein 2/3; DG2/DG3;
Gene ID 1823
mRNA Refseq NM_004948
Protein Refseq NP_004939
MIM 125643
UniProt ID Q08554

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DSC1 Products

Required fields are marked with *

My Review for All DSC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon