Recombinant Human DRD5, GST-tagged

• Cat.No.: DRD5-13H
• Product Overview: Recombinant Human DRD5, fused with N-terminal GST, was expressed in E. coli.

Specification

• Description: This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2.
• Source: E. coli
• Species: Human
• Tag: GST
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
• Bio-activity: Not tested.
• AA Sequence: NSSLNPVIYAFNADFQKVFAQLLGCSHFCSRTPVETVNISNELISYNQDIVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDPVAESVWELDCEGEISLDKITPFTPNGFH(C-127aa encoded by BC009748)
• Storage: Aliquot and store at -20ºC to -80ºC for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20ºC to -80ºC.

Gene Information

• Gene Name: DRD5 dopamine receptor D5 [ Homo sapiens (human) ]
• Official Symbol: DRD5
• Synonyms: DRD5; dopamine receptor D5; DBDR; DRD1B; DRD1L2; D(1B) dopamine receptor; D1beta dopamine receptor; d(5) dopamine receptor; dopamine D5 receptor; dopamine receptor D1B
• Gene ID: 1816
• mRNA Refseq: NM_000798
• Protein Refseq: NP_000789
• MIM: 126453
• UniProt ID: P21918
• Chromosome Location: 4p16.1
• Pathway: Amine ligand-binding receptors; Calcium signaling pathway; Defective ACTH causes Obesity and Pro-opiomelanocortinin deficiency (POMCD)
• Function: G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity