Recombinant Human DRD3 protein, His-tagged

• Cat.No.: DRD3-2945H
• Product Overview: Recombinant Human DRD3 protein, fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPTIAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQ
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DRD3 dopamine receptor D3 [ Homo sapiens ]
• Official Symbol: DRD3
• Synonyms: DRD3; dopamine receptor D3; D(3) dopamine receptor; essential tremor 1; dopamine D3 receptor; D3DR; ETM1; FET1; MGC149204; MGC149205
• Gene ID: 1814
• mRNA Refseq: NM_000796
• Protein Refseq: NP_000787
• MIM: 126451
• UniProt ID: P35462