Recombinant Human DRD1

• Cat.No.: DRD1-10H
• Product Overview: Recombinant Human DRD1, fused without tag, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: This gene encodes the D1 subtype of the dopamine receptor. The D1 subtype is the most abundant dopamine receptor in the central nervous system. This G-protein coupled receptor stimulates adenylyl cyclase and activates cyclic AMP-dependent protein kinases. D1 receptors regulate neuronal growth and development, mediate some behavioral responses, and modulate dopamine receptor D2-mediated events. Alternate transcription initiation sites result in two transcript variants of this gene.
• Form: Liquid
• Molecular Mass: 49.3 kDa
• AA Sequence: MRTLNTSAMDGTGLVVERDFSVRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNFFVISLAVSDLLVAV LVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTL SVLISFIPVQLSWHKAKPTSPSDGNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQI RRIAALERAAVHAKNCQTTTGNGKPVECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGS GETQPFCIDSNTFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHH EPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT
• Applications: Antibody Production; Functional Study; Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: DRD1 dopamine receptor D1 [ Homo sapiens (human) ]
• Official Symbol: DRD1
• Synonyms: DRD1; dopamine receptor D1; DADR; DRD1A; D(1A) dopamine receptor; dopamine D1 receptor
• Gene ID: 1812
• mRNA Refseq: NM_000794
• Protein Refseq: NP_000785
• MIM: 126449
• UniProt ID: P21728
• Chromosome Location: 5q35.1
• Pathway: Amine ligand-binding receptor; Amphetamine addiction; Class A/1 (Rhodopsin-like receptors)
• Function: G-protein coupled amine receptor activity; dopamine binding; dopamine neurotransmitter receptor activity