Recombinant Human DRAXIN protein, His-tagged
Cat.No. : | DRAXIN-3000H |
Product Overview : | Recombinant Human DRAXIN protein(171-349 aa), fused to His tag, was expressed in E. coli. |
Availability | March 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 171-349 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QVLDAAMEESSTSLAPTMFFLTTFEAAPATEESLILPVTSLRPQQAQPRSDGEVMPTLDMALFDWTDYEDLKPDGWPSAKKKEKHRGKLSSDGNETSPAEGEPCDHHQDCLPGTCCDLREHLCTPHNRGLNNKCFDDCMCVEGLRCYAKFHRNRRVTRRKGRCVEPETANGDQGSFINV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DRAXIN dorsal inhibitory axon guidance protein [ Homo sapiens ] |
Official Symbol | DRAXIN |
Synonyms | UNQ3119; neucrin; AGPA3119; C1orf187 |
Gene ID | 374946 |
mRNA Refseq | NM_198545.3 |
Protein Refseq | NP_940947.3 |
MIM | 612682 |
UniProt ID | Q8NBI3 |
◆ Recombinant Proteins | ||
DRAXIN-2875H | Recombinant Human DRAXIN Protein, GST-tagged | +Inquiry |
DRAXIN-1977H | Recombinant Human DRAXIN Protein (26-349 aa), His-SUMO-tagged | +Inquiry |
DRAXIN-3408Z | Recombinant Zebrafish DRAXIN | +Inquiry |
DRAXIN-4821M | Recombinant Mouse DRAXIN Protein | +Inquiry |
DRAXIN-745H | Recombinant Human DRAXIN Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DRAXIN Products
Required fields are marked with *
My Review for All DRAXIN Products
Required fields are marked with *
0
Inquiry Basket