Recombinant Human DRAP1 Protein, GST-tagged

• Cat.No.: DRAP1-2873H
• Product Overview: Human DRAP1 full-length ORF ( NP_006433.2, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Transcriptional repression is a general mechanism for regulating transcriptional initiation in organisms ranging from yeast to humans. Accurate initiation of transcription from eukaryotic protein-encoding genes requires the assembly of a large multiprotein complex consisting of RNA polymerase II and general transcription factors such as TFIIA, TFIIB, and TFIID. DR1 is a repressor that interacts with the TATA-binding protein (TBP) of TFIID and prevents the formation of an active transcription complex by precluding the entry of TFIIA and/or TFIIB into the preinitiation complex. The protein encoded by this gene is a corepressor of transcription that interacts with DR1 to enhance DR1-mediated repression. The interaction between this corepressor and DR1 is required for corepressor function and appears to stabilize the TBP-DR1-DNA complex. [provided by RefSeq, Jul 2008]
• Molecular Mass: 48.7 kDa
• AA Sequence: MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLLKKACQVTQSRNAKTMTTSHLKQCIELEQQFDFLKDLVASVPDMQGDGEDNHMDGDKGARRGRKPGSGGRKNGGMGTKSKDKKLSGTDSEQEDESEDTDTDGEEETSQPPPQASHPSAHFQSPPTPFLPFASTLPLPPAPPGPSAPDEEDEEDYDS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DRAP1 DR1-associated protein 1 (negative cofactor 2 alpha) [ Homo sapiens ]
• Official Symbol: DRAP1
• Synonyms: DRAP1; DR1-associated protein 1 (negative cofactor 2 alpha); dr1-associated corepressor; DR1 associated corepressor; NC2 alpha; negative cofactor 2 alpha; negative co-factor 2-alpha; NC2-alpha
• Gene ID: 10589
• mRNA Refseq: NM_006442
• Protein Refseq: NP_006433
• MIM: 602289
• UniProt ID: Q14919