Recombinant Human DPYSL2, GST-tagged

Description :	This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.96 kDa
AA Sequence :	PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGA QIDDNIPRRTTQRIVAPPGGRANITSL
Applications :	ELISA; WB-Re; AP; Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	DPYSL2?dihydropyrimidinase-like 2 [?Homo sapiens?(human) ]
Official Symbol	DPYSL2
Synonyms	DPYSL2; DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2; dihydropyrimidinase-like 2; dihydropyrimidinase-related protein 2; unc-33-like phosphoprotein 2; collapsin response mediator protein hCRMP-2
Gene ID	1808
mRNA Refseq	NM_001386
Protein Refseq	NP_001377
MIM	602463
UniProt ID	Q16555
Chromosome Location	8p22-p21
Pathway	BDNF signaling pathway; CRMPs in Sema3A signaling; Regulation of Microtubule Cytoskeleton
Function	dihydropyrimidinase activity; protein binding; protein kinase binding