Recombinant Human DPYSL2, GST-tagged

Cat.No. : DPYSL2-102H
Product Overview : Recombinant Human DPYSL2(470 a.a. - 571 a.a.), fused with GST-tag at N-terminal, was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Molecular Mass : 36.96 kDa
AA Sequence : PRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGA QIDDNIPRRTTQRIVAPPGGRANITSL
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DPYSL2?dihydropyrimidinase-like 2 [?Homo sapiens?(human) ]
Official Symbol DPYSL2
Synonyms DPYSL2; DRP2; N2A3; CRMP2; DRP-2; ULIP2; CRMP-2; DHPRP2; ULIP-2; dihydropyrimidinase-like 2; dihydropyrimidinase-related protein 2; unc-33-like phosphoprotein 2; collapsin response mediator protein hCRMP-2
Gene ID 1808
mRNA Refseq NM_001386
Protein Refseq NP_001377
MIM 602463
UniProt ID Q16555
Chromosome Location 8p22-p21
Pathway BDNF signaling pathway; CRMPs in Sema3A signaling; Regulation of Microtubule Cytoskeleton
Function dihydropyrimidinase activity; protein binding; protein kinase binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DPYSL2 Products

Required fields are marked with *

My Review for All DPYSL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon