Recombinant Human DPYS Protein, GST-tagged
Cat.No. : | DPYS-2862H |
Product Overview : | Human DPYS full-length ORF ( ADZ15412.1, 1 a.a. - 519 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 57.1 kDa |
AA Sequence : | MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSWADPKVCCDYSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DPYS dihydropyrimidinase [ Homo sapiens ] |
Official Symbol | DPYS |
Synonyms | DPYS; dihydropyrimidinase; DHPase; hydantoinase; dihydropyrimidine amidohydrolase; DHP; |
Gene ID | 1807 |
mRNA Refseq | NM_001385 |
Protein Refseq | NP_001376 |
MIM | 613326 |
UniProt ID | Q14117 |
◆ Recombinant Proteins | ||
DPYS-0254H | Recombinant Human DPYS protein, His&GST-tagged | +Inquiry |
DPYS-4167HF | Recombinant Full Length Human DPYS Protein, GST-tagged | +Inquiry |
DPYS-1948R | Recombinant Rat DPYS Protein | +Inquiry |
DPYS-3808H | Recombinant Human DPYS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DPYS-4811M | Recombinant Mouse DPYS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPYS-001HCL | Recombinant Human DPYS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPYS Products
Required fields are marked with *
My Review for All DPYS Products
Required fields are marked with *
0
Inquiry Basket