Recombinant Human DPYS Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DPYS-3808H |
Product Overview : | DPYS MS Standard C13 and N15-labeled recombinant protein (NP_001376) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria. |
Molecular Mass : | 56.6 kDa |
AA Sequence : | MAAPSRLLIRGGRVVNDDFSEVADVLVEDGVVRALGHDLLPPGGAPAGLRVLDAAGKLVLPGGIDTHTHMQFPFMGSRSIDDFHQGTKAALSGGTTMIIDFAIPQKGGSLIEAFETWRSWADPKVCCDYSLHVAVTWWSDQVKEEMKILVQDKGVNSFKMFMAYKDLYMVTDLELYEAFSRCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEGHELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAASLGTDGTHYWNKEWHHAAHHVMGPPLRPDPSTPDFLMNLLANDDLTTTGTDNCTFNTCQKALGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKIFNLYPRKGRIAVGSDADIVIWDPKGTRTISAKTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DPYS dihydropyrimidinase [ Homo sapiens (human) ] |
Official Symbol | DPYS |
Synonyms | DPYS; dihydropyrimidinase; DHPase; hydantoinase; dihydropyrimidine amidohydrolase; DHP; |
Gene ID | 1807 |
mRNA Refseq | NM_001385 |
Protein Refseq | NP_001376 |
MIM | 613326 |
UniProt ID | Q14117 |
◆ Recombinant Proteins | ||
Dpys-2650M | Recombinant Mouse Dpys Protein, Myc/DDK-tagged | +Inquiry |
DPYS-3808H | Recombinant Human DPYS Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DPYS-12157H | Recombinant Human DPYS, His-tagged | +Inquiry |
DPYS-242H | Recombinant Human DPYS, Gly&Pro tagged | +Inquiry |
DPYS-2519M | Recombinant Mouse DPYS Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPYS-001HCL | Recombinant Human DPYS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPYS Products
Required fields are marked with *
My Review for All DPYS Products
Required fields are marked with *
0
Inquiry Basket