Recombinant Human DPYD

Cat.No. : DPYD-28435TH
Product Overview : Recombinant Human DPYD (1a.a. - 173 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidine metabolism associated with thymine-uraciluria and an increased risk of toxicity in cancer patients receiving 5-fluorouracil chemotherapy. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 44.66 kDa
AA Sequence : MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFDDIKHTTLGERGALRE AMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGPI NIGGLQQFATETLILAFSLMNHL
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DPYD dihydropyrimidine dehydrogenase [ Homo sapiens (human) ]
Official Symbol DPYD
Synonyms DPYD; DHP; DPD; DHPDHASE; dihydropyrimidine dehydrogenase; dihydropyrimidine dehydrogenase [NADP(+)]; dihydrouracil dehydrogenase; dihydrothymine dehydrogenase; NP_000101.2; EC 1.3.1.2; NP_001153773.1
Gene ID 1806
mRNA Refseq NM_000110
Protein Refseq NP_000101
MIM 612779
UniProt ID Q12882
Chromosome Location 1p22
Pathway Drug metabolism - other enzymes; Pantothenate and CoA biosynthesis; beta-Alanine metabolism
Function 4 iron, 4 sulfur cluster binding; dihydroorotate oxidase activity; dihydropyrimidine dehydrogenase (NADP+) activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DPYD Products

Required fields are marked with *

My Review for All DPYD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon