Recombinant Human DPYD

• Cat.No.: DPYD-28435TH
• Product Overview: Recombinant Human DPYD (1a.a. - 173 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Description: The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidine metabolism associated with thymine-uraciluria and an increased risk of toxicity in cancer patients receiving 5-fluorouracil chemotherapy. Two transcript variants encoding different isoforms have been found for this gene.
• Source: Wheat germ
• Species: Human
• Tag: Non
• Molecular Mass: 44.66 kDa
• AA Sequence: MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFDDIKHTTLGERGALRE AMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGPI NIGGLQQFATETLILAFSLMNHL
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DPYD dihydropyrimidine dehydrogenase [ Homo sapiens (human) ]
• Official Symbol: DPYD
• Synonyms: DPYD; DHP; DPD; DHPDHASE; dihydropyrimidine dehydrogenase; dihydropyrimidine dehydrogenase [NADP(+)]; dihydrouracil dehydrogenase; dihydrothymine dehydrogenase; NP_000101.2; EC 1.3.1.2; NP_001153773.1
• Gene ID: 1806
• mRNA Refseq: NM_000110
• Protein Refseq: NP_000101
• MIM: 612779
• UniProt ID: Q12882
• Chromosome Location: 1p22
• Pathway: Drug metabolism - other enzymes; Pantothenate and CoA biosynthesis; beta-Alanine metabolism
• Function: 4 iron, 4 sulfur cluster binding; dihydroorotate oxidase activity; dihydropyrimidine dehydrogenase (NADP+) activity