Recombinant Human DPYD
Cat.No. : | DPYD-28435TH |
Product Overview : | Recombinant Human DPYD (1a.a. - 173 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidine metabolism associated with thymine-uraciluria and an increased risk of toxicity in cancer patients receiving 5-fluorouracil chemotherapy. Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 44.66 kDa |
AA Sequence : | MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKHWKRNPDKNCFNCEKLENNFDDIKHTTLGERGALRE AMRCLKCADAPCQKSCPTNLDIKSFITSIANKNYYGAAKMIFSDNPLGLTCGMVCPTSDLCVGGCNLYATEEGPI NIGGLQQFATETLILAFSLMNHL |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DPYD dihydropyrimidine dehydrogenase [ Homo sapiens (human) ] |
Official Symbol | DPYD |
Synonyms | DPYD; DHP; DPD; DHPDHASE; dihydropyrimidine dehydrogenase; dihydropyrimidine dehydrogenase [NADP(+)]; dihydrouracil dehydrogenase; dihydrothymine dehydrogenase; NP_000101.2; EC 1.3.1.2; NP_001153773.1 |
Gene ID | 1806 |
mRNA Refseq | NM_000110 |
Protein Refseq | NP_000101 |
MIM | 612779 |
UniProt ID | Q12882 |
Chromosome Location | 1p22 |
Pathway | Drug metabolism - other enzymes; Pantothenate and CoA biosynthesis; beta-Alanine metabolism |
Function | 4 iron, 4 sulfur cluster binding; dihydroorotate oxidase activity; dihydropyrimidine dehydrogenase (NADP+) activity |
◆ Recombinant Proteins | ||
DPYD-1947R | Recombinant Rat DPYD Protein | +Inquiry |
DPYD-1606R | Recombinant Rat DPYD Protein, His (Fc)-Avi-tagged | +Inquiry |
DPYD-4810M | Recombinant Mouse DPYD Protein | +Inquiry |
DPYD-4165HF | Recombinant Full Length Human DPYD Protein, GST-tagged | +Inquiry |
DPYD-2728H | Recombinant Human DPYD protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DPYD Products
Required fields are marked with *
My Review for All DPYD Products
Required fields are marked with *
0
Inquiry Basket