Recombinant Human DPM2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DPM2-1501H
• Product Overview: DPM2 MS Standard C13 and N15-labeled recombinant protein (NP_003854) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Dolichol-phosphate mannose (Dol-P-Man) serves as a donor of mannosyl residues on the lumenal side of the endoplasmic reticulum (ER). Lack of Dol-P-Man results in defective surface expression of GPI-anchored proteins. Dol-P-Man is synthesized from GDP-mannose and dolichol-phosphate on the cytosolic side of the ER by the enzyme dolichyl-phosphate mannosyltransferase. The protein encoded by this gene is a hydrophobic protein that contains 2 predicted transmembrane domains and a putative ER localization signal near the C terminus. This protein associates with DPM1 in vivo and is required for the ER localization and stable expression of DPM1 and also enhances the binding of dolichol-phosphate to DPM1.
• Molecular Mass: 9.3 kDa
• AA Sequence: MATGTDQVVGLGLVAVSLIIFTYYTAWVILLPFIDSQHVIHKYFLPRAYAVAIPLAAGLLLLLFVGLFISYVMLKSKRVTKKAQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DPM2 dolichyl-phosphate mannosyltransferase subunit 2, regulatory [ Homo sapiens (human) ]
• Official Symbol: DPM2
• Synonyms: DPM2; dolichyl-phosphate mannosyltransferase polypeptide 2, regulatory subunit; dolichol phosphate-mannose biosynthesis regulatory protein; MGC21559; MGC111193; dolichol phosphate-mannose synthase 2; FLJ80013
• Gene ID: 8818
• mRNA Refseq: NM_003863
• Protein Refseq: NP_003854
• MIM: 603564
• UniProt ID: O94777