Recombinant Human DPCD protein, His-tagged

Cat.No. : DPCD-477H
Product Overview : Recombinant Human DPCD protein(NP_056263)(1-203 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-203 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MAVTGWLESLRTAQKTALLQDGRRKVHYLFPDGKEMAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVDQKERCIIVRTTNKKYYKKFSIPDLDRHQLPLDDALLSFAHANCTLIISYQKPKEVVVAESELQKELKKVKTAHSNDGDCKTQ
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DPCD deleted in primary ciliary dyskinesia homolog (mouse) [ Homo sapiens ]
Official Symbol DPCD
Synonyms DPCD; deleted in primary ciliary dyskinesia homolog (mouse); protein DPCD; DKFZP566F084; RP11 529I10.4; deleted in a mouse model of primary ciliary dyskinesia; RP11-529I10.4; DKFZp566F084;
Gene ID 25911
mRNA Refseq NM_015448
Protein Refseq NP_056263
UniProt ID Q9BVM2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DPCD Products

Required fields are marked with *

My Review for All DPCD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon