Recombinant Human DPAGT1 Protein, GST-tagged

Description :	The protein encoded by this gene is an enzyme that catalyzes the first step in the dolichol-linked oligosaccharide pathway for glycoprotein biosynthesis. This enzyme belongs to the glycosyltransferase family 4. This protein is an integral membrane protein of the endoplasmic reticulum. The congenital disorder of glycosylation type Ij is caused by mutation in the gene encoding this enzyme. [provided by RefSeq, Jul 2008]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	34.76 kDa
AA Sequence :	IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTVHQSETEDGEFTECNNMTLINLLLKVLGPIHER
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	DPAGT1 dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase) [ Homo sapiens ]
Official Symbol	DPAGT1
Synonyms	DPAGT1; dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P transferase); DPAGT, DPAGT2; UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase; ALG7; CDG Ij; D11S366; DGPT; GPT; GlcNAc-1-P transferase; N-acetylglucosamine-1-phosphate transferase; dolichyl-phosphate alpha-N-acetylglucosaminyltransferase; UDP-GlcNAc:dolichyl-phosphate N-acetylglucosaminephosphotransferase; dolichyl-phosphate (UDP-N-acetylglucosamine) N-acetylglucosaminephosphotransferase 1 (GlcNAc-1-P tra; G1PT; UAGT; UGAT; CDG1J; DPAGT; CDG-Ij; DPAGT2;
Gene ID	1798
mRNA Refseq	NM_001382
Protein Refseq	NP_001373
MIM	191350
UniProt ID	Q9H3H5