Recombinant Human DOCK5 protein, His-tagged

• Cat.No.: DOCK5-1368H
• Product Overview: Recombinant Human DOCK5 protein(Q9H7D0)(Lys261-Val350), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Pro1691-Pro1840
• Tag: C-His
• Form: Phosphate buffered saline
• Molecular Mass: 19 kDa
• Storage: Store at -20°C/-80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PSRPGSDGSILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKAQRPKSLQLMDNRLSPFHGSSPPQSTPLSPPPLTPKATRTLSSPSLQTDGIAATPVPPPPPPKSKPYEGSQRNSTELAPP

Gene Information

• Gene Name: DOCK5 dedicator of cytokinesis 5 [ Homo sapiens ]
• Official Symbol: DOCK5
• Synonyms: DOCK5; dedicator of cytokinesis 5; dedicator of cytokinesis protein 5; FLJ21034; DKFZp451J181; DKFZp779M164; DKFZp781J211
• Gene ID: 80005
• mRNA Refseq: NM_024940
• Protein Refseq: NP_079216
• UniProt ID: Q9H7D0