Recombinant Human DOCK5 protein, His-tagged
Cat.No. : | DOCK5-1368H |
Product Overview : | Recombinant Human DOCK5 protein(Q9H7D0)(Lys261-Val350), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Pro1691-Pro1840 |
Tag : | C-His |
Form : | Phosphate buffered saline |
Molecular Mass : | 19 kDa |
Storage : | Store at -20°C/-80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PSRPGSDGSILEPLLERRASSGARVEDLSLREENSENRISKFKRKDWSLSKSQVIAEKAPEPDLMSPTRKAQRPKSLQLMDNRLSPFHGSSPPQSTPLSPPPLTPKATRTLSSPSLQTDGIAATPVPPPPPPKSKPYEGSQRNSTELAPP |
Gene Name | DOCK5 dedicator of cytokinesis 5 [ Homo sapiens ] |
Official Symbol | DOCK5 |
Synonyms | DOCK5; dedicator of cytokinesis 5; dedicator of cytokinesis protein 5; FLJ21034; DKFZp451J181; DKFZp779M164; DKFZp781J211; |
Gene ID | 80005 |
mRNA Refseq | NM_024940 |
Protein Refseq | NP_079216 |
UniProt ID | Q9H7D0 |
◆ Recombinant Proteins | ||
Dock5-1368M | Recombinant Mouse Dock5 Protein, His-tagged | +Inquiry |
DOCK5-2807H | Recombinant Human DOCK5 Protein, GST-tagged | +Inquiry |
DOCK5-2224H | Recombinant Human DOCK5 Protein (Arg425-Cys609), N-His tagged | +Inquiry |
DOCK5-1368H | Recombinant Human DOCK5 protein, His-tagged | +Inquiry |
DOCK5-4755M | Recombinant Mouse DOCK5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DOCK5 Products
Required fields are marked with *
My Review for All DOCK5 Products
Required fields are marked with *
0
Inquiry Basket