Recombinant Human DOCK4 Protein, GST-tagged

• Cat.No.: DOCK4-2806H
• Product Overview: Human DOCK4 partial ORF ( NP_055520, 1867 a.a. - 1966 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of the dedicator of cytokinesis (DOCK) family and encodes a protein with a DHR-1 (CZH-1) domain, a DHR-2 (CZH-2) domain and an SH3 domain. This membrane-associated, cytoplasmic protein functions as a guanine nucleotide exchange factor and is involved in regulation of adherens junctions between cells. Mutations in this gene have been associated with ovarian, prostate, glioma, and colorectal cancers. Alternatively spliced variants which encode different protein isoforms have been described, but only one has been fully characterized. [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DOCK4 dedicator of cytokinesis 4 [ Homo sapiens ]
• Official Symbol: DOCK4
• Synonyms: DOCK4; dedicator of cytokinesis 4; dedicator of cytokinesis protein 4; FLJ34238; KIAA0716; MGC134911; MGC134912
• Gene ID: 9732
• mRNA Refseq: NM_014705
• Protein Refseq: NP_055520
• MIM: 607679
• UniProt ID: Q8N1I0