Recombinant Human DNMT3B protein, GST-tagged
Cat.No. : | DNMT3B-3712H |
Product Overview : | Recombinant Human DNMT3B protein(1-100 aa), fused to GST tag, was expressed in E. coli. |
Availability | April 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-100 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MKGDTRHLNGEEDAGGREDSILVNGACSDQSSDSPPILEAIRTPEIRGRRSSSRLSKREVSSLLSYTQDLTGDGDGEDGDGSDTPVMPKLFRETRTRSES |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DNMT3B DNA (cytosine-5-)-methyltransferase 3 beta [ Homo sapiens ] |
Official Symbol | DNMT3B |
Synonyms | DNMT3B; DNA (cytosine-5-)-methyltransferase 3 beta; DNA (cytosine-5)-methyltransferase 3B; DNA MTase HsaIIIB; DNA methyltransferase HsaIIIB; ICF; ICF1; M.HsaIIIB; |
Gene ID | 1789 |
mRNA Refseq | NM_001207055 |
Protein Refseq | NP_001193984 |
MIM | 602900 |
UniProt ID | Q9UBC3 |
◆ Recombinant Proteins | ||
DNMT3B-2198C | Recombinant Chicken DNMT3B | +Inquiry |
Dnmt3b-2622M | Recombinant Mouse Dnmt3b Protein, Myc/DDK-tagged | +Inquiry |
DNMT3B-4052HF | Recombinant Full Length Human DNMT3B Protein, GST-tagged | +Inquiry |
DNMT3B-2680Z | Recombinant Zebrafish DNMT3B | +Inquiry |
DNMT3B-2792H | Recombinant Human DNMT3B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNMT3B-6854HCL | Recombinant Human DNMT3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNMT3B Products
Required fields are marked with *
My Review for All DNMT3B Products
Required fields are marked with *
0
Inquiry Basket