Recombinant Human DNMT3A, His-tagged

• Cat.No.: DNMT3A-20H
• Product Overview: Recombinant Human DNMT3A protein(NP_072046.2)(680-902aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.9kDa
• Protein length: 680-902aa
• AA Sequence: KIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLF
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: DNMT3A DNA (cytosine-5-)-methyltransferase 3 alpha [ Homo sapiens ]
• Official Symbol: DNMT3A
• Synonyms: DNMT3A; DNA (cytosine-5-)-methyltransferase 3 alpha; DNA (cytosine-5)-methyltransferase 3A; DNA MTase HsaIIIA; DNA cytosine methyltransferase 3A2; DNMT3A2; M.HsaIIIA
• Gene ID: 1788
• mRNA Refseq: NM_022552.4
• Protein Refseq: NP_072046.2
• MIM: 602769
• UniProt ID: Q9Y6K1