Recombinant Human DNM1L protein(501-570 aa), C-His-tagged

• Cat.No.: DNM1L-2457H
• Product Overview: Recombinant Human DNM1L protein(O00429)(501-570 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 501-570 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: FADACGLMNNNIEEQRRNRLARELPSAVSRDKSSKVPSALAPASQEPSPAASAEADGKLIQDSRRETKNV

Gene Information

• Gene Name: DNM1L dynamin 1-like [ Homo sapiens ]
• Official Symbol: DNM1L
• Synonyms: DNM1L; dynamin 1-like; dynamin-1-like protein; DRP1; DVLP; DYMPLE; HDYNIV; VPS1; dynamin-like protein 4; dynamin-like protein IV; Dnm1p/Vps1p-like protein; dynamin-related protein 1; dynamin family member proline-rich carboxyl-terminal domain less; DLP1; EMPF; DYNIV-11; FLJ41912
• Gene ID: 10059
• mRNA Refseq: NM_005690
• Protein Refseq: NP_005681
• MIM: 603850
• UniProt ID: O00429