Recombinant Human DNASE1L3 protein

Cat.No. : DNASE1L3-4417H
Product Overview : Recombinant Human DNASE1L3 protein(Q13609)(21-305aa), was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 21-305aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 33.4 kDa
AA Sequence : MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name DNASE1L3 deoxyribonuclease I-like 3 [ Homo sapiens ]
Official Symbol DNASE1L3
Synonyms DNASE1L3; deoxyribonuclease I-like 3; deoxyribonuclease gamma; DNAS1L3; DNase gamma; LSD; LS-DNase; DNase I-like 3; Liver and spleen DNase; DNase I homolog protein 2; DNase I homolog protein DHP2; deoxyribonuclease I-like III; DHP2; SLEB16;
Gene ID 1776
mRNA Refseq NM_001256560
Protein Refseq NP_001243489
MIM 602244
UniProt ID Q13609

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DNASE1L3 Products

Required fields are marked with *

My Review for All DNASE1L3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon