Recombinant Human DNASE1L3 Full Length protein, His-tagged

• Cat.No.: DNASE1L3-29H
• Product Overview: Recombinant Human DNASE1L3 Full Length protein(Q13609), fused with N-terminal His tag, was expressed in Insect Cells.

Specification

• Source: Insect Cells
• Species: Human
• Tag: His
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 35.8 kDa
• AASequence: MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: DNASE1L3 deoxyribonuclease 1 like 3 [ Homo sapiens (human) ]
• Official Symbol: DNASE1L3
• Synonyms: Deoxyribonuclease gamma; Deoxyribonuclease I like 3; Deoxyribonuclease I like III; Deoxyribonuclease I-like 3; DHP 2; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I like 3; DNase I-like 3; DNASE1L3; DNSL3_HUMAN; Liver and spleen DNase; LS DNase; LS-DNase; LSD; SLEB 16; SLEB16
• Gene ID: 1776
• mRNA Refseq: NM_001256560
• Protein Refseq: NP_001243489
• MIM: 602244
• UniProt ID: Q13609