Recombinant Human DNASE1L3 Full Length protein, His-tagged
Cat.No. : | DNASE1L3-29H |
Product Overview : | Recombinant Human DNASE1L3 Full Length protein(Q13609), fused with N-terminal His tag, was expressed in Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 35.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
Gene Name | DNASE1L3 deoxyribonuclease 1 like 3 [ Homo sapiens (human) ] |
Official Symbol | DNASE1L3 |
Synonyms | Deoxyribonuclease gamma; Deoxyribonuclease I like 3; Deoxyribonuclease I like III; Deoxyribonuclease I-like 3; DHP 2; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I like 3; DNase I-like 3; DNASE1L3; DNSL3_HUMAN; Liver and spleen DNase; LS DNase; LS-DNase; LSD; SLEB 16; SLEB16 |
Gene ID | 1776 |
mRNA Refseq | NM_001256560 |
Protein Refseq | NP_001243489 |
MIM | 602244 |
UniProt ID | Q13609 |
◆ Recombinant Proteins | ||
DNASE1L3-2269M | Recombinant Mouse DNASE1L3 protein, His-tagged | +Inquiry |
DNASE1L3-4219H | Recombinant Human DNASE1L3 protein, His&Myc-tagged | +Inquiry |
DNASE1L3-3273C | Recombinant Chicken DNASE1L3 | +Inquiry |
DNASE1L3-2464M | Recombinant Mouse DNASE1L3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNASE1L3-1919R | Recombinant Rat DNASE1L3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNASE1L3-6864HCL | Recombinant Human DNASE1L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNASE1L3 Products
Required fields are marked with *
My Review for All DNASE1L3 Products
Required fields are marked with *
0
Inquiry Basket