Recombinant Human DNASE1 protein(61-130 aa), C-His-tagged

• Cat.No.: DNASE1-2702H
• Product Overview: Recombinant Human DNASE1 protein(P24855)(61-130 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 61-130 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: EVRDSHLTAVGKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYDDGCEPCGNDT
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: DNASE1 deoxyribonuclease I [ Homo sapiens ]
• Official Symbol: DNASE1
• Synonyms: DNASE1; deoxyribonuclease I; DNL1; deoxyribonuclease-1; Dornase alfa; DNase I, lysosomal; human urine deoxyribonuclease I; DRNI; FLJ38093; FLJ44902; DKFZp686H0155
• Gene ID: 1773
• mRNA Refseq: NM_005223
• Protein Refseq: NP_005214
• MIM: 125505
• UniProt ID: P24855