Recombinant Human DNAL4, His-tagged

• Cat.No.: DNAL4-26062TH
• Product Overview: Recombinant full length Human Dynein light chain with an N terminal His tag ; predicted mwt: 14.1 kDa

Specification

• Description: DNAL4 is a component of the dynein motor complex (Iwasaki et al.
• Protein length: 105 amino acids
• Conjugation: HIS
• Molecular Weight: 14.100kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
• Sequence Similarities: Belongs to the dynein light chain family.

Gene Information

• Gene Name: DNAL4 dynein, axonemal, light chain 4 [ Homo sapiens ]
• Official Symbol: DNAL4
• Synonyms: DNAL4; dynein, axonemal, light chain 4; dynein, axonemal, light 4 , dynein, axonemal, light polypeptide 4; dynein light chain 4, axonemal; dJ327J16; PIG27
• Gene ID: 10126
• mRNA Refseq: NM_005740
• Protein Refseq: NP_005731
• MIM: 610565
• Uniprot ID: O96015
• Chromosome Location: 22q13.1
• Pathway: Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; Retrograde neurotrophin signalling, organism-specific biosystem; Signal Transduction, organism-specific biosystem
• Function: ATPase activity, coupled; microtubule motor activity