Recombinant Full Length Human DNAL4 Protein, GST-tagged

• Cat.No.: DNAL4-4030HF
• Product Overview: Human DNAL4 full-length ORF ( AAH02968, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. [provided by RefSeq, Dec 2014]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 37.29 kDa
• Protein length: 105 amino acids
• AA Sequence: MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAL4 dynein, axonemal, light chain 4 [ Homo sapiens ]
• Official Symbol: DNAL4
• Synonyms: DNAL4; dynein, axonemal, light chain 4; dynein, axonemal, light 4 , dynein, axonemal, light polypeptide 4; dynein light chain 4, axonemal; dJ327J16; PIG27; dynein, axonemal, light 4; proliferation-inducing gene 27; dynein light chain, outer arm 4; proliferation-inducing protein 27; dynein, axonemal, light polypeptide 4
• Gene ID: 10126
• mRNA Refseq: NM_005740
• Protein Refseq: NP_005731
• MIM: 610565
• UniProt ID: O96015