Recombinant Human DNAJC4 Protein, GST-tagged

• Cat.No.: DNAJC4-2762H
• Product Overview: Human DNAJC4 full-length ORF (AAH44584.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DNAJC4 (DnaJ Heat Shock Protein Family (Hsp40) Member C4) is a Protein Coding gene. GO annotations related to this gene include unfolded protein binding.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 52.91 kDa
• AA Sequence: MPPLLPLRLCRLWPRNPPSRLLGAAAGQRSRPSTYYELLGVHPGASTEEVKRAFFSKSKELHPDRDPGNPSLHSRFVELSEAYRVLSREQSRRSYDDQLRSGSPPKSPRTTVHDKSAHQTHSSWTPPNAQYWSQFHSVRPQGPQLRQQQHKQNKQVLGYCLLLMLAGMGLHYIAFRKVKQMHLNFMDEKDRIITAFYNEARARARANRGILQQERQRLGQRQPPPSEPTQGPEIVPRGAGP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DNAJC4 DnaJ (Hsp40) homolog, subfamily C, member 4 [ Homo sapiens ]
• Official Symbol: DNAJC4
• Synonyms: DNAJC4; DnaJ (Hsp40) homolog, subfamily C, member 4; HSPF2; MCG18; DANJC4
• Gene ID: 3338
• mRNA Refseq: NM_005528
• Protein Refseq: NP_005519
• MIM: 604189
• UniProt ID: Q9NNZ3