Recombinant Human DNAJC2, His-tagged
Cat.No. : | DNAJC2-26774TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 189-621 of Human DNAJC2 with N terminal His tag; Predicted MWt 51kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 189-621 a.a. |
Description : | This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 125 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | NSRWSNKKNVPKLGDMNSSFEDVDIFYSFWYNFDSWREFS YLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRI RTLVDNAYSCDPRIKKFKEEEKAKKEAEKKAKAEAKRK EQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEK DIQKKAIKKERQKLRNSCKTWNHFSDNEAERVKMMEEVEK LCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINE QIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDD LQLLIKAVNLFPAGTNSRWEVIANYMNIHSSSGVKRTA KDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQ ADNATPSERFEGPYTDFTPWTTEEQKLLEQALKTYPVNTP ERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQ VLNASRAKK |
Sequence Similarities : | Contains 1 J domain.Contains 2 SANT domains. |
Gene Name | DNAJC2 DnaJ (Hsp40) homolog, subfamily C, member 2 [ Homo sapiens ] |
Official Symbol | DNAJC2 |
Synonyms | DNAJC2; DnaJ (Hsp40) homolog, subfamily C, member 2; ZRF1, zuotin related factor 1; dnaJ homolog subfamily C member 2; MPHOSPH11; MPP11; ZUO1; zuotin; |
Gene ID | 27000 |
mRNA Refseq | NM_014377 |
Protein Refseq | NP_055192 |
MIM | 605502 |
Uniprot ID | Q99543 |
Chromosome Location | 7q22-q32 |
Function | DNA binding; Hsp70 protein binding; chromatin binding; histone binding; ubiquitin binding; |
◆ Recombinant Proteins | ||
BMP4-263H | Recombinant Human BMP4 protein, His-tagged | +Inquiry |
RFL23334EF | Recombinant Full Length Escherichia Coli Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
SAOUHSC-01685-3516S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01685 protein, His-tagged | +Inquiry |
VEGFA-587H | Recombinant Human Tumor Necrosis Factor (Ligand) Superfamily, Member 11, His-Fc-Tagged | +Inquiry |
MYL10-1133H | Recombinant Human MYL10, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-320H | Native Human Albumin Rhodamine | +Inquiry |
Cry1Ab-523 | Native Bacillus thuringiensis Cry1Ab Protein | +Inquiry |
TF-48P | Native Pig Transferrin (TRF) Protein | +Inquiry |
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
GGT1-371P | Native Porcine Gamma-Glutamyltransferase 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF6-2108MCL | Recombinant Mouse SLAMF6 cell lysate | +Inquiry |
CHRNB2-7512HCL | Recombinant Human CHRNB2 293 Cell Lysate | +Inquiry |
TAS2R3-1244HCL | Recombinant Human TAS2R3 293 Cell Lysate | +Inquiry |
TMEM218-965HCL | Recombinant Human TMEM218 293 Cell Lysate | +Inquiry |
ASGR1-3084MCL | Recombinant Mouse ASGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DNAJC2 Products
Required fields are marked with *
My Review for All DNAJC2 Products
Required fields are marked with *
0
Inquiry Basket