Recombinant Human DNAJC12 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DNAJC12-5329H
• Product Overview: DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_957714) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.3 kDa
• AA Sequence: MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGATTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DNAJC12 DnaJ heat shock protein family (Hsp40) member C12 [ Homo sapiens (human) ]
• Official Symbol: DNAJC12
• Synonyms: DNAJC12; DnaJ (Hsp40) homolog, subfamily C, member 12; dnaJ homolog subfamily C member 12; J domain protein 1; JDP1; j domain-containing protein 1; J domain containing protein 1 (JDP1); RP11-57G10.2
• Gene ID: 56521
• mRNA Refseq: NM_201262
• Protein Refseq: NP_957714
• MIM: 606060
• UniProt ID: Q9UKB3