Recombinant Human DNAJC12 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DNAJC12-5329H
Product Overview : DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_957714) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene.
Molecular Mass : 12.3 kDa
AA Sequence : MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGATTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DNAJC12 DnaJ heat shock protein family (Hsp40) member C12 [ Homo sapiens (human) ]
Official Symbol DNAJC12
Synonyms DNAJC12; DnaJ (Hsp40) homolog, subfamily C, member 12; dnaJ homolog subfamily C member 12; J domain protein 1; JDP1; j domain-containing protein 1; J domain containing protein 1 (JDP1); RP11-57G10.2;
Gene ID 56521
mRNA Refseq NM_201262
Protein Refseq NP_957714
MIM 606060
UniProt ID Q9UKB3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DNAJC12 Products

Required fields are marked with *

My Review for All DNAJC12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon