Recombinant Human DNAJB3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DNAJB3-4754H
Product Overview : DNAJB3 MS Standard C13 and N15-labeled recombinant protein (NP_001001394) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : DNAJB3 (DnaJ Heat Shock Protein Family (Hsp40) Member B3) is a Protein Coding gene.
Molecular Mass : 16.6 kDa
AA Sequence : MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DNAJB3 DnaJ heat shock protein family (Hsp40) member B3 [ Homo sapiens (human) ]
Official Symbol DNAJB3
Synonyms DNAJB3; DnaJ (Hsp40) homolog, subfamily B, member 3; dnaJ homolog subfamily B member 3; HCG3; MGC26879;
Gene ID 414061
mRNA Refseq NM_001001394
Protein Refseq NP_001001394
UniProt ID Q8WWF6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DNAJB3 Products

Required fields are marked with *

My Review for All DNAJB3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon