Recombinant Human DNAJB3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DNAJB3-4754H
• Product Overview: DNAJB3 MS Standard C13 and N15-labeled recombinant protein (NP_001001394) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: DNAJB3 (DnaJ Heat Shock Protein Family (Hsp40) Member B3) is a Protein Coding gene.
• Molecular Mass: 16.6 kDa
• AA Sequence: MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DNAJB3 DnaJ heat shock protein family (Hsp40) member B3 [ Homo sapiens (human) ]
• Official Symbol: DNAJB3
• Synonyms: DNAJB3; DnaJ (Hsp40) homolog, subfamily B, member 3; dnaJ homolog subfamily B member 3; HCG3; MGC26879
• Gene ID: 414061
• mRNA Refseq: NM_001001394
• Protein Refseq: NP_001001394
• UniProt ID: Q8WWF6