Recombinant Human DMTF1 Protein, GST-tagged

• Cat.No.: DMTF1-2717H
• Product Overview: Human DMTF1 partial ORF ( NP_066968, 661 a.a. - 760 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]
• Molecular Mass: 36.74 kDa
• AA Sequence: KQEESPSDLASAYVTEGLESPTIEEQVDQTIDDETILIVPSPHGFIQASDVIDTESVLPLTTLTDPILQHHQEESNIIGSSLGSPVSEDSKDVEDLVNCH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DMTF1 cyclin D binding myb-like transcription factor 1 [ Homo sapiens ]
• Official Symbol: DMTF1
• Synonyms: DMTF1; cyclin D binding myb-like transcription factor 1; cyclin-D-binding Myb-like transcription factor 1; cyclin D binding Myb like protein; DMP1; DMTF; hDMP1; hDMTF1; cyclin D-binding Myb-like protein; cyclin-D-interacting Myb-like protein 1; FLJ25188; FLJ41265; FLJ76054
• Gene ID: 9988
• mRNA Refseq: NM_001142326
• Protein Refseq: NP_001135798
• MIM: 608491
• UniProt ID: Q9Y222