Recombinant Human DMRTC2 Protein, GST-tagged

• Cat.No.: DMRTC2-2716H
• Product Overview: Human DMRTC2 full-length ORF (BAB71473.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DMRTC2 (DMRT Like Family C2) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is DMRTC1.
• Molecular Mass: 50.7 kDa
• AA Sequence: MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRLCLSQACECHKCVHILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQVPSGKENIAPQPQTPHGAVLLAPTPPGKPCTQLQPVPSAPAELLWASAAQPSPGSLALVLDSGASWPLGPWTLAASRLLHATTSGVPPAVPRTCCLSASLPWL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DMRTC2 DMRT-like family C2 [ Homo sapiens ]
• Official Symbol: DMRTC2
• Synonyms: DMRTC2; DMRT-like family C2; doublesex- and mab-3-related transcription factor C2
• Gene ID: 63946
• mRNA Refseq: NM_001040283
• Protein Refseq: NP_001035373
• MIM: 614806
• UniProt ID: Q8IXT2