Recombinant Human DMRTC2 Protein, GST-tagged
Cat.No. : | DMRTC2-2716H |
Product Overview : | Human DMRTC2 full-length ORF (BAB71473.1, 1 a.a. - 224 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | DMRTC2 (DMRT Like Family C2) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. An important paralog of this gene is DMRTC1. |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MEPSDMPAGYHCPLDSAPWDETRDPQSTELIPRRAISRSPTCARCRNHGVTAHLKGHKRLCLSQACECHKCVHILERRRVMAAQVALRRQQEAQLKKHLMRRGEASPKAPNHFRKGTTQPQVPSGKENIAPQPQTPHGAVLLAPTPPGKPCTQLQPVPSAPAELLWASAAQPSPGSLALVLDSGASWPLGPWTLAASRLLHATTSGVPPAVPRTCCLSASLPWL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DMRTC2 DMRT-like family C2 [ Homo sapiens ] |
Official Symbol | DMRTC2 |
Synonyms | DMRTC2; DMRT-like family C2; doublesex- and mab-3-related transcription factor C2; |
Gene ID | 63946 |
mRNA Refseq | NM_001040283 |
Protein Refseq | NP_001035373 |
MIM | 614806 |
UniProt ID | Q8IXT2 |
◆ Recombinant Proteins | ||
DMRTC2-4659M | Recombinant Mouse DMRTC2 Protein | +Inquiry |
DMRTC2-2421M | Recombinant Mouse DMRTC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
DMRTC2-139H | Recombinant Human DMRTC2 Protein, GST-HIS-tagged | +Inquiry |
DMRTC2-2716H | Recombinant Human DMRTC2 Protein, GST-tagged | +Inquiry |
DMRTC2-4041HF | Recombinant Full Length Human DMRTC2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DMRTC2-6897HCL | Recombinant Human DMRTC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DMRTC2 Products
Required fields are marked with *
My Review for All DMRTC2 Products
Required fields are marked with *
0
Inquiry Basket