Recombinant Human DMGDH Protein, GST-tagged

Cat.No. : DMGDH-2705H
Product Overview : Human DMGDH partial ORF ( NP_037523.2, 556 a.a. - 665 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes an enzyme involved in the catabolism of choline, catalyzing the oxidative demethylation of dimethylglycine to form sarcosine. The enzyme is found as a monomer in the mitochondrial matrix, and uses flavin adenine dinucleotide and folate as cofactors. Mutation in this gene causes dimethylglycine dehydrogenase deficiency, characterized by a fishlike body odor, chronic muscle fatigue, and elevated levels of the muscle form of creatine kinase in serum. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Molecular Mass : 37.84 kDa
AA Sequence : ANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSELHDLRWIEEEAVKGGYDVEIKNITDELGVLGVAGPQARKVLQKLTSEDLSDDVFKFLQTKSLKVS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DMGDH dimethylglycine dehydrogenase [ Homo sapiens (human) ]
Official Symbol DMGDH
Synonyms DMGDH; dimethylglycine dehydrogenase; Dimethylglycine Dehydrogenase; ME2GLYDH; Dimethylglycine Dehydrogenase, Mitochondrial; EC 1.5.8.4; DMGDHD; dimethylglycine dehydrogenase, mitochondrial; EC 1.5.8.4
Gene ID 29958
mRNA Refseq NM_013391
Protein Refseq NP_037523
MIM 605849
UniProt ID Q9UI17

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DMGDH Products

Required fields are marked with *

My Review for All DMGDH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon