Recombinant Human DMGDH Protein, GST-tagged

• Cat.No.: DMGDH-2705H
• Product Overview: Human DMGDH partial ORF ( NP_037523.2, 556 a.a. - 665 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an enzyme involved in the catabolism of choline, catalyzing the oxidative demethylation of dimethylglycine to form sarcosine. The enzyme is found as a monomer in the mitochondrial matrix, and uses flavin adenine dinucleotide and folate as cofactors. Mutation in this gene causes dimethylglycine dehydrogenase deficiency, characterized by a fishlike body odor, chronic muscle fatigue, and elevated levels of the muscle form of creatine kinase in serum. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]
• Molecular Mass: 37.84 kDa
• AA Sequence: ANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSELHDLRWIEEEAVKGGYDVEIKNITDELGVLGVAGPQARKVLQKLTSEDLSDDVFKFLQTKSLKVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DMGDH dimethylglycine dehydrogenase [ Homo sapiens (human) ]
• Official Symbol: DMGDH
• Synonyms: DMGDH; dimethylglycine dehydrogenase; Dimethylglycine Dehydrogenase; ME2GLYDH; Dimethylglycine Dehydrogenase, Mitochondrial; EC 1.5.8.4; DMGDHD; dimethylglycine dehydrogenase, mitochondrial; EC 1.5.8.4
• Gene ID: 29958
• mRNA Refseq: NM_013391
• Protein Refseq: NP_037523
• MIM: 605849
• UniProt ID: Q9UI17