Recombinant Human DMGDH Protein, GST-tagged
Cat.No. : | DMGDH-2705H |
Product Overview : | Human DMGDH partial ORF ( NP_037523.2, 556 a.a. - 665 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an enzyme involved in the catabolism of choline, catalyzing the oxidative demethylation of dimethylglycine to form sarcosine. The enzyme is found as a monomer in the mitochondrial matrix, and uses flavin adenine dinucleotide and folate as cofactors. Mutation in this gene causes dimethylglycine dehydrogenase deficiency, characterized by a fishlike body odor, chronic muscle fatigue, and elevated levels of the muscle form of creatine kinase in serum. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Molecular Mass : | 37.84 kDa |
AA Sequence : | ANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSELHDLRWIEEEAVKGGYDVEIKNITDELGVLGVAGPQARKVLQKLTSEDLSDDVFKFLQTKSLKVS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DMGDH dimethylglycine dehydrogenase [ Homo sapiens (human) ] |
Official Symbol | DMGDH |
Synonyms | DMGDH; dimethylglycine dehydrogenase; Dimethylglycine Dehydrogenase; ME2GLYDH; Dimethylglycine Dehydrogenase, Mitochondrial; EC 1.5.8.4; DMGDHD; dimethylglycine dehydrogenase, mitochondrial; EC 1.5.8.4 |
Gene ID | 29958 |
mRNA Refseq | NM_013391 |
Protein Refseq | NP_037523 |
MIM | 605849 |
UniProt ID | Q9UI17 |
◆ Recombinant Proteins | ||
DMGDH-2705H | Recombinant Human DMGDH Protein, GST-tagged | +Inquiry |
DMGDH-4645M | Recombinant Mouse DMGDH Protein | +Inquiry |
DMGDH-2411M | Recombinant Mouse DMGDH Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DMGDH Products
Required fields are marked with *
My Review for All DMGDH Products
Required fields are marked with *
0
Inquiry Basket