Recombinant Human DMBX1 Protein, GST-tagged

• Cat.No.: DMBX1-2701H
• Product Overview: Human DMBX1 full-length ORF ( NP_757379.1, 1 a.a. - 377 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008]
• Molecular Mass: 67.1 kDa
• AA Sequence: MQHYGVNGYSLHAMNSLSAMYNLHQQAAQQAQHAPDYRPSVHALTLAERLADIILEARYGSQHRKQRRSRTAFTAQQLEALEKTFQKTHYPDVVMRERLAMCTNLPEARVQVWFKNRRAKFRKKQRSLQKEQLQKQKEAEGSHGEGKAEAPTPDTQLDTEQPPRLPGSDPPAELHLSLSEQSASESAPEDQPDREEDPRAGAEDPKAEKSPGADSKGLGCKRGSPKADSPGSLTITPVAPGGGLLGPSHSYSSSPLSLFRLQEQFRQHMAATNNLVHYSSFEVGGPAPAAAAAAAAVPYLGVNMAPLGSLHCQSYYQSLSAAAAAHQGVWGSPLLPAPPAGLAPASATLNSKTTSIENLRLRAKQHAASLGLDTLPN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DMBX1 diencephalon/mesencephalon homeobox 1 [ Homo sapiens ]
• Official Symbol: DMBX1
• Synonyms: DMBX1; diencephalon/mesencephalon homeobox 1; orthodenticle homolog 3 (Drosophila) , OTX3; diencephalon/mesencephalon homeobox protein 1; PAXB; homeoprotein MBX; orthodenticle homolog 3; paired-like homeobox protein DMBX1; MBX; OTX3
• Gene ID: 127343
• mRNA Refseq: NM_147192
• Protein Refseq: NP_671725
• MIM: 607410
• UniProt ID: Q8NFW5