Recombinant Human DLL4 Protein, GST-tagged

• Cat.No.: DLL4-2687H
• Product Overview: Human DLL4 partial ORF ( NP_061947, 123 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a homolog of the Drosophila delta gene. The delta gene family encodes Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. [provided by RefSeq, Jul 2008]
• Molecular Mass: 36.63 kDa
• AA Sequence: HAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DLL4 delta-like 4 (Drosophila) [ Homo sapiens ]
• Official Symbol: DLL4
• Synonyms: DLL4; delta-like 4 (Drosophila); delta like 4 homolog (Drosophila); delta-like protein 4; delta4; delta 4; delta ligand 4; notch ligand DLL4; delta-like 4 homolog; delta-like 4 protein; notch ligand delta-2; drosophila Delta homolog 4; hdelta2; MGC126344
• Gene ID: 54567
• mRNA Refseq: NM_019074
• Protein Refseq: NP_061947
• MIM: 605185
• UniProt ID: Q9NR61