Recombinant Human DLK2 Protein, GST-tagged

• Cat.No.: DLK2-2684H
• Product Overview: Human DLK2 full-length ORF ( NP_076421.2, 1 a.a. - 383 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DLK2 (Delta Like Non-Canonical Notch Ligand 2) is a Protein Coding gene. Among its related pathways are Canonical and Non-canonical Notch signaling and P38 MAPK Signaling Pathway (sino). GO annotations related to this gene include calcium ion binding and protein heterodimerization activity. An important paralog of this gene is DLK1.
• Molecular Mass: 66.9 kDa
• AA Sequence: MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCLPGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLMRPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEAGLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQVSMLPAGLPLPRDLPPEPGKTTAL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DLK2 delta-like 2 homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: DLK2
• Synonyms: DLK2; delta-like 2 homolog (Drosophila); EGF like domain, multiple 9 , EGFL9; protein delta homolog 2; MGC2487; DLK-2; EGF-like protein 9; EGF-like-domain, multiple 9; epidermal growth factor-like protein 9; EGFL9; MGC111055
• Gene ID: 65989
• mRNA Refseq: NM_023932
• Protein Refseq: NP_076421
• UniProt ID: Q6UY11