Recombinant Human DLK1 protein, His-tagged

• Cat.No.: DLK1-2820H
• Product Overview: Recombinant Human DLK1 protein(P80370)(24-303aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.8 kDa
• Protein length: 24-303aa
• AA Sequence: AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: DLK1 delta-like 1 homolog (Drosophila) [ Homo sapiens ]
• Official Symbol: DLK1
• Synonyms: DLK1; delta-like 1 homolog (Drosophila); delta like homolog (Drosophila); protein delta homolog 1; Delta1; FA1; pG2; Pref 1; ZOG; DLK-1; secredeltin; fetal antigen 1; preadipocyte factor 1; DLK; PREF1; Pref-1
• Gene ID: 8788
• mRNA Refseq: NM_003836
• Protein Refseq: NP_003827
• MIM: 176290
• UniProt ID: P80370