Recombinant Human DLK1 protein, His-tagged
Cat.No. : | DLK1-2820H |
Product Overview : | Recombinant Human DLK1 protein(P80370)(24-303aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 24-303aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.8 kDa |
AA Sequence : | AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLTEGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | DLK1 delta-like 1 homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | DLK1 |
Synonyms | DLK1; delta-like 1 homolog (Drosophila); delta like homolog (Drosophila); protein delta homolog 1; Delta1; FA1; pG2; Pref 1; ZOG; DLK-1; secredeltin; fetal antigen 1; preadipocyte factor 1; DLK; PREF1; Pref-1; |
Gene ID | 8788 |
mRNA Refseq | NM_003836 |
Protein Refseq | NP_003827 |
MIM | 176290 |
UniProt ID | P80370 |
◆ Recombinant Proteins | ||
DLK1-1347H | Recombinant Human DLK1 Protein, His&GST-tagged | +Inquiry |
DLK1-26164TH | Recombinant Human DLK1, FLAG-tagged | +Inquiry |
DLK1-2820H | Recombinant Human DLK1 protein, His-tagged | +Inquiry |
DLK1-26914TH | Recombinant Human DLK1, Fc-tagged | +Inquiry |
DLK1-5007H | Recombinant Human DLK1 protein, Flag-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLK1-6909HCL | Recombinant Human DLK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLK1 Products
Required fields are marked with *
My Review for All DLK1 Products
Required fields are marked with *
0
Inquiry Basket