Recombinant Human DKK2 Protein, GST-tagged

• Cat.No.: DKK2-2666H
• Product Overview: Human DKK2 full-length ORF (BAG35574.1, 1 a.a. - 259 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. It can act as either an agonist or antagonist of Wnt/beta-catenin signaling, depending on the cellular context and the presence of the co-factor kremen 2. Activity of this protein is also modulated by binding to the Wnt co-receptor LDL-receptor related protein 6 (LRP6). [provided by RefSeq, Jul 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 54.89 kDa
• AA Sequence: MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DKK2 dickkopf 2 homolog (Xenopus laevis) [ Homo sapiens ]
• Official Symbol: DKK2
• Synonyms: DKK2; dickkopf 2 homolog (Xenopus laevis); dickkopf (Xenopus laevis) homolog 2; dickkopf-related protein 2; hDkk-2; dickkopf-2; dickkopf homolog 2; dickkopf related protein-2; DKK-2
• Gene ID: 27123
• mRNA Refseq: NM_014421
• Protein Refseq: NP_055236
• MIM: 605415
• UniProt ID: Q9UBU2