Recombinant Human DIRAS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : DIRAS1-3539H
Product Overview : DIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_660156) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS) superfamily of monomeric GTPases.
Molecular Mass : 22.3 kDa
AA Sequence : MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name DIRAS1 DIRAS family GTPase 1 [ Homo sapiens (human) ]
Official Symbol DIRAS1
Synonyms DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; ras-related inhibitor of cell growth; small GTP-binding tumor suppressor 1; distinct subgroup of the Ras family member 1; Di-Ras1; FLJ42681;
Gene ID 148252
mRNA Refseq NM_145173
Protein Refseq NP_660156
MIM 607862
UniProt ID O95057

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DIRAS1 Products

Required fields are marked with *

My Review for All DIRAS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon