Recombinant Human DIRAS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DIRAS1-3539H
• Product Overview: DIRAS1 MS Standard C13 and N15-labeled recombinant protein (NP_660156) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS) superfamily of monomeric GTPases.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.3 kDa
• AA Sequence: MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DIRAS1 DIRAS family GTPase 1 [ Homo sapiens (human) ]
• Official Symbol: DIRAS1
• Synonyms: DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; ras-related inhibitor of cell growth; small GTP-binding tumor suppressor 1; distinct subgroup of the Ras family member 1; Di-Ras1; FLJ42681
• Gene ID: 148252
• mRNA Refseq: NM_145173
• Protein Refseq: NP_660156
• MIM: 607862
• UniProt ID: O95057