Recombinant Full Length Human DIRAS1 Protein, GST-tagged

• Cat.No.: DIRAS1-2570HF
• Product Overview: Human DIRAS1 full-length ORF ( NP_660156.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.[supplied by OMIM, Apr 2004]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 48.7 kDa
• Protein length: 198 amino acids
• AA Sequence: MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DIRAS1 DIRAS family, GTP-binding RAS-like 1 [ Homo sapiens ]
• Official Symbol: DIRAS1
• Synonyms: DIRAS1; DIRAS family, GTP-binding RAS-like 1; GTP-binding protein Di-Ras1; Di Ras1; GBTS1; RIG; ras-related inhibitor of cell growth; small GTP-binding tumor suppressor 1; distinct subgroup of the Ras family member 1; Di-Ras1; FLJ42681
• Gene ID: 148252
• mRNA Refseq: NM_145173
• Protein Refseq: NP_660156
• MIM: 607862
• UniProt ID: O95057