Recombinant Human DIO2 protein, GST-tagged

• Cat.No.: DIO2-3650H
• Product Overview: Recombinant Human DIO2 protein(171-273 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 171-273 aa
• AA Sequence: AIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRMDNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKRUKKTRLAG
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DIO2 deiodinase, iodothyronine, type II [ Homo sapiens ]
• Official Symbol: DIO2
• Synonyms: DIO2; deiodinase, iodothyronine, type II; type II iodothyronine deiodinase; SelY; thyroxine deiodinase; type II; TXDI2; type 2 DI; type-II 5deiodinase; type-II 5-deiodinase; thyroxine deiodinase, type II; type 2 iodothyronine deiodinase; D2; 5DII; DIOII
• Gene ID: 1734
• mRNA Refseq: NM_000793
• Protein Refseq: NP_000784
• MIM: 601413
• UniProt ID: Q92813